tech@sbsbio.com
from China, for the World
for
S
uperior
B
iology
S
ervices since
2000
Home
Product
All Products
Custom Services
Catalog Products
Innovative Systems
Nucleic Acid Related
Natural Compounds
Synthetic Biology
Enzymes
POCT Solution
LAMP
RPA
CRISPR
DNA-Free Enzymes
Freeze-Drying System
Lateral Flow System
About
About SBS
Achievements
Ecosystem
Legal Statement
Contact
…
Home
Product
All Products
Custom Services
Catalog Products
Innovative Systems
Nucleic Acid Related
Natural Compounds
Synthetic Biology
Enzymes
POCT Solution
LAMP
RPA
CRISPR
DNA-Free Enzymes
Freeze-Drying System
Lateral Flow System
About
About SBS
Achievements
Ecosystem
Legal Statement
Contact
Login
tech@sbsbio.com
from China, for the World
for
S
uperior
B
iology
S
ervices since
2000
Home
Product
All Products
Custom Services
Catalog Products
Innovative Systems
Nucleic Acid Related
Natural Compounds
Synthetic Biology
Enzymes
POCT Solution
LAMP
RPA
CRISPR
DNA-Free Enzymes
Freeze-Drying System
Lateral Flow System
About
About SBS
Achievements
Ecosystem
Legal Statement
Contact
…
Home
Product
All Products
Custom Services
Catalog Products
Innovative Systems
Nucleic Acid Related
Natural Compounds
Synthetic Biology
Enzymes
POCT Solution
LAMP
RPA
CRISPR
DNA-Free Enzymes
Freeze-Drying System
Lateral Flow System
About
About SBS
Achievements
Ecosystem
Legal Statement
Contact
Login
All Categories - SBS Genetech - for Superior Biology Services since 2000
All
Synthetic Biology
DNA-Free Enzymes
RUO Kits
Magnetic Beads
Reference Standard
Next Generation Sequencing
Microspheres
Natural Compounds
Exosome
Quick-Dissolve Pellets
Sequencing
Glycobiology
Signal Transduction
IVD Bulk Reagents
Peptide-Related
Protein-Related
PCR-Related
RNA-Related
Enzyme
Isothermal Amplification
RNA Silencing
Nucleic Acid Purification
Antibody
DNA Stain
Nuclease
Biochemicals
Extracts
DNA Markers
CRISPR Gene Editing
Genetic Manipulation
Lab Supplies
Nucleic Acid Test
Freeze-Drying System
Lateral Flow System
Cell-Related
Buy now
Recombinant Maltose Binding Protein (His-tag) 1
Beyotime&#39;s Recombinant Maltose Binding Protein (His-tag) was expressed in Escherichia coli (E. coli) and purified, which contains the mature form of maltose binding protein (27-392aa) with 6X His-tag (HHHHHH) at the C-terminus.<br>The maltose binding protein (MBP), also known as MalE, is a key component of the maltose/maltodextrin ATP-binding cassette (ABC) transporter system in E. coli. It resides in the periplasm and specifically binds maltose and maltodextrins such as maltotriose with high affinity. Upon substrate binding, MBP undergoes a conformational change and interacts with the maltose transporter complex (MalFGK₂), facilitating the ATP-dependent active transport of the ligand into the cytoplasm [1].
$132.00 - $1,100.00
Buy now
Recombinant Maltose Binding Protein (His-tag)
Beyotime's Recombinant Maltose Binding Protein (His-tag) was expressed in Escherichia coli (E. coli) and purified, which contains the mature form of maltose binding protein (27-392aa) with 6X His-tag (HHHHHH) at the C-terminus.<br>The maltose binding protein (MBP), also known as MalE, is a key component of the maltose/maltodextrin ATP-binding cassette (ABC) transporter system in E. coli. It resides in the periplasm and specifically binds maltose and maltodextrins such as maltotriose with high affinity. Upon substrate binding, MBP undergoes a conformational change and interacts with the maltose transporter complex (MalFGK₂), facilitating the ATP-dependent active transport of the ligand into the cytoplasm [1].
$132.00 - $1,100.00
Buy now
Recombinant Human TIM4 (His-Tag&Avi-Tag)
Beyotime's Recombinant Human TIM4 (His-Tag&Avi-Tag) was expressed in HEK293 and purified, which contain the extracellular domain (25-314aa) of human TIM4 with His-Tag and Avi-Tag fusion at the C-terminus.<br>TIMs are type I transmembrane proteins, with the N terminus containing the variable Ig-like (IgV) domain extending from the plasma membrane and the C-terminal tail largely mediating intracellular signaling oriented toward the cytosol. The Tim gene family consists of eight members (Tim-1-8) on mouse chromosome 11B1.1 and three members (Tim-1, Tim-3, and Tim-4) on human chromosome 5q33.2. TIM1, TIM2, and TIM3 were all found to be expressed by T cells and involved in the regulation of Th cells. TIM4 is different from other TIM molecules in that it is expressed exclusively on antigen-presenting cells (APCs), particularly on mature myeloid-derived DCs and macrophages but not by lymphocytes.<br>Mature human TIM4 consists of a 290aa extracellular domain (ECD), a 21aa transmembrane segment and a 43aa cytoplasmic tail. TIM4 is involved in immune regulation such as to initiate skewed Th2 polarization and to mediate phagocytosis of apoptotic cells. TIM4 also binds specifically to TIM1 which is
$166.00 - $7,666.00
Buy now
Recombinant Biotinylated Human TIM4 (Avi-Tag)
Beyotime's Recombinant Biotinylated Human TIM4 (Avi-Tag) was expressed in E.coli and purified, which contain the Ig-like V domain (25-126aa) of full length of TIM-4 with His-Tag and Avi-Tag fusion at the C-terminus. Biotin Labeling Kit for Avi-tag Protein with BirA (P0630) was used to achieve biotin labeling of Human TIM4.<br>TIMs are type I transmembrane proteins, with the N terminus containing the variable Ig-like (IgV) domain extending from the plasma membrane and the C-terminal tail largely mediating intracellular signaling oriented toward the cytosol. The Tim gene family consists of eight members (Tim-1-8) on mouse chromosome 11B1.1 and three members (Tim-1, Tim-3, and Tim-4) on human chromosome 5q33.2. TIM1, TIM2, and TIM3 were all found to be expressed by T cells and involved in the regulation of Th cells. TIM4 is different from other TIM molecules in that it is expressed exclusively on antigen-presenting cells (APCs), particularly on mature myeloid-derived DCs and macrophages but not by lymphocytes.<br>Mature human TIM4 consists of a 290aa extracellular domain (ECD), a 21aa transmembrane segment and a 43aa cytoplasmic tail. TIM4 is involved in immune regulation such as to initiat
$200.00 - $2,333.00
Buy now
Recombinant Human MBD2 (hFc-Tag, HEK293)
Beyotime's recombinant human MBD2 (hFc-Tag) contains the Methyl-CpG-binding domain (Ala143-Leu230) with Fc (Fragment crystallizable) region of human IgG1 fusion at the C-terminus. Fusion with the Fc domain can improve the solubility and stability of protein both in vivo and in vitro. This protein was expressed in HEK293 cells and purified. Due to N-glycosylation site and hinge region of hFc, it migrates as an approximately 40kDa/80kDa protein in SDS-PAGE gel under reduced/non-reduced conditions.<br>DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian transcriptional regulation. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, except for MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. The MBD2 protein encoded by the MBD2 gene may function as a mediator of the biological consequences of the methylation signal. It is also reported that this protein functions as a demethylase to activate transcription, as DNA meth
$76.00 - $2,733.00
Buy now
Recombinant Active Human COX1 (His & Twin-Strep-Tag)
Beyotime's recombinant human active form of human COX1 (rhCOX1) was expressed in HEK293 cells and purified, which contains the full length of COX1 (24-599aa) with a His tag (8X His) and a Twin-Strep tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK) at the C-terminus.<br>Cyclooxygenase is a bifunctional enzyme that first catalyzes the addition of two moles of molecular oxygen to arachidonic acid to form the hydroperoxide PGG2, then reduces the hydroperoxide to the alcohol, PGH2, by a peroxidase activity. Cyclooxygenase is found in two forms: COX1, which is constitutively expressed in most cells, is responsible for the production of prostaglandins that maintain homeostasis; and COX2, which is upregulated in inflammatory cells in response to an inflammatory stimulus (cytokines, LPS, etc.), is responsible for the production of prostaglandins at the site of inflammation [1].
$533.00 - $6,333.00
Buy now
Recombinant Active Human COX1 (His & Twin-Strep-Tag)
Beyotime's recombinant human active form of human COX1 (rhCOX1) was expressed in HEK293 cells and purified, which contains the full length of COX1 (24-599aa) with a His tag (8X His) and a Twin-Strep tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK) at the C-terminus.<br>Cyclooxygenase is a bifunctional enzyme that first catalyzes the addition of two moles of molecular oxygen to arachidonic acid to form the hydroperoxide PGG2, then reduces the hydroperoxide to the alcohol, PGH2, by a peroxidase activity. Cyclooxygenase is found in two forms: COX1, which is constitutively expressed in most cells, is responsible for the production of prostaglandins that maintain homeostasis; and COX2, which is upregulated in inflammatory cells in response to an inflammatory stimulus (cytokines, LPS, etc.), is responsible for the production of prostaglandins at the site of inflammation [1].
$533.00 - $6,333.00
Buy now
Recombinant Human Rac2 (Flag-Tag)
Beyotime's recombinant human Rac2 (rhRac2) was expressed in E.coli and purified, which contains the mature form Rac2 (2-189aa) with Flag tag (DYKDDDDK) at C-terminus. Rac2 involves in the regulation of cell growth, cytoskeletal reorganization, and the activation of protein kinases by regulating the expression of effector proteins. Rac2 has also been shown to interact with ARHGDIA and Nitric oxide synthase 2A [1].
$160.00 - $4,666.00
Buy now
Recombinant Human Rac1 (T17N, Flag-Tag)
Beyotime's recombinant human Rac1 T17N (rhRac1 T17N) was expressed in E.coli and purified, which contains the mature form Rac1 (2-189aa) with Flag tag (DYKDDDDK) at the C-terminus. Rac1 is involved in the regulation a diverse array of cellular events, including the control of GLUT4 translocation to glucose uptake, cell growth, cytoskeletal reorganization, antimicrobial cytotoxicity, and the activation of protein kinases [1]. T17N is a dominant negative mutation on the p-loop that prevents GTP binding and reduces GDP binding [2-3].
$160.00 - $3,767.00
Buy now
Recombinant Human Rac1 (Q61L, Flag-Tag)
Beyotime's recombinant human Rac1 Q61L (rhRac1 Q61L) was expressed in E.coli and purified, which contains the mature form Rac1 (2-189aa) with Flag tag (DYKDDDDK) at the C-terminus. Rac1 is involved in the regulation a diverse array of cellular events, including the control of GLUT4 translocation to glucose uptake, cell growth, cytoskeletal reorganization, antimicrobial cytotoxicity, and the activation of protein kinases [1].<br>Rac1 Q61L is a constitutively active Rac1 mutant that locks Rac1 at the GTP-bound state by disrupting its GTPase activity [2-3].
$160.00 - $3,767.00
Buy now
Recombinant Human Rac1 (Flag-Tag)
Beyotime's recombinant human Rac1 (rhRac1) was expressed in E.coli and purified, which contains the mature form Rac1 (2-189aa) with Flag tag (DYKDDDDK) at the C-terminus.<br>Rac1 is involved in the regulation a diverse array of cellular events, including the control of GLUT4 translocation to glucose uptake, cell growth, cytoskeletal reorganization, antimicrobial cytotoxicity and the activation of protein kinases [1].
$160.00 - $2,900.00
Buy now
Recombinant Human Cdc42 (G12V, Flag-Tag)
Beyotime's recombinant human Cdc42 (rhCdc42 G12V) was expressed in E.coli and purified, which contains the mature form Cdc42 (2-188aa) with Flag tag (DYKDDDDK) at the C-terminus.<br>Cdc42 is involved in the regulation of a variety of tumor and non-tumor diseases through a cascade of multiple signaling pathways. Active Cdc42 can regulate intercellular adhesion, cytoskeleton formation, and cell cycle, thus affecting cell proliferation, transformation, and dynamic balance as well as migration and invasion of tumor cells by regulating the expression of effector proteins [1].<br>G12V and Q61L mutations of CDC42 cause GAP insensitivity leading to sustained hyperactivation of CDC42 [2-3].
$160.00 - $3,766.00
Buy now
Recombinant Human Cdc42 (Q61L, Flag-Tag)
Beyotime's recombinant human Cdc42 (rhCdc42 Q61L) was expressed in E.coli and purified, which contains the mature form Cdc42 (2-188aa) with Flag tag (DYKDDDDK) at the C-terminus.<br>Cdc42 is involved in the regulation of a variety of tumor and non-tumor diseases through a cascade of multiple signaling pathways. Active Cdc42 can regulate intercellular adhesion, cytoskeleton formation, and cell cycle, thus affecting cell proliferation, transformation, and dynamic balance as well as migration and invasion of tumor cells by regulating the expression of effector proteins [1].<br>G12V and Q61L mutations of CDC42 cause GAP insensitivity leading to sustained hyperactivation of CDC42 [2-3].
$160.00 - $3,766.00
Buy now
Recombinant Human Cdc42 (Flag-Tag)
Beyotime's recombinant human Cdc42 (rhCdc42) was expressed in E.coli and purified, which contains the mature form Cdc42 (2-188aa) with Flag tag (DYKDDDDK) at the C-terminus. Cdc42 is involved in the regulation of a variety of tumor and non-tumor diseases through a cascade of multiple signaling pathways. Active Cdc42 can regulate intercellular adhesion, cytoskeleton formation, and cell cycle, thus affecting cell proliferation, transformation, and dynamic balance as well as migration and invasion of tumor cells by regulating the expression of effector proteins [1].
$133.00 - $2,900.00
Buy now
Recombinant Human KRas4B (Q61H, His-Tag)
Beyotime’s recombinant human KRas4B Q61H (rhKRas4B Q61H) was expressed in E.coli and purified, which mutate the code 12 glycine to cysteine of the mature form KRas4B (2-186aa) fusion with 6X His tag (HHHHHH) at the N-terminus.<br>KRas gene located on the 12p11.1–12p12.1. The KRas is a member of the small GTPase superfamily, which encodes two highly related protein isoforms, KRas4B and KRas4A. KRas4B and KRas4A consist of 188 and 189 amino acids, respectively, due to different clipping of the fourth exon in mammalian cells. These proteins have different structures in their C-terminal region. KRas4B contains a polybasic stretch of eight lysines and KRas4A presents a palmitoylated cysteine and two polybasic regions. The localization and trafficking of KRas4B relies on the presence of polybasic residues that anchor the protein to the inner leaflet of the plasma membrane, whereas the membrane-targeting signals in KRas4A are two polybasic regions and an additional palmitoyl group, that independently contribute to the plasma membrane localization and signal output.<br>The term KRas is generally referred to as KRas4B due to the high level of mRNA encoding KRas4B in cells. KRas4B is by far the mo
$133.00 - $5,666.00
Buy now
Recombinant Human KRas4B (G13S, His-Tag)
Beyotime’s recombinant human KRas4B G13S (rhKRas4B G13S) was expressed in E.coli and purified, which mutate the code 12 glycine to cysteine of the mature form KRas4B (2-186aa) fusion with 6X His tag (HHHHHH) at the N-terminus.<br>KRas gene located on the 12p11.1–12p12.1. The KRas is a member of the small GTPase superfamily, which encodes two highly related protein isoforms, KRas4B and KRas4A. KRas4B and KRas4A consist of 188 and 189 amino acids, respectively, due to different clipping of the fourth exon in mammalian cells. These proteins have different structures in their C-terminal region. KRas4B contains a polybasic stretch of eight lysines and KRas4A presents a palmitoylated cysteine and two polybasic regions. The localization and trafficking of KRas4B relies on the presence of polybasic residues that anchor the protein to the inner leaflet of the plasma membrane, whereas the membrane-targeting signals in KRas4A are two polybasic regions and an additional palmitoyl group, that independently contribute to the plasma membrane localization and signal output.<br>The term KRas is generally referred to as KRas4B due to the high level of mRNA encoding KRas4B in cells. KRas4B is by far the mo
$133.00 - $5,666.00
Buy now
Recombinant Human KRas4B (G13D, His-Tag)
Beyotime’s recombinant human KRas4B G13D (rhKRas4B G13D) was expressed in E.coli and purified, which mutate the code 12 glycine to cysteine of the mature form KRas4B (2-186aa) fusion with 6X His tag (HHHHHH) at the N-terminus.<br>KRas gene located on the 12p11.1–12p12.1. The KRas is a member of the small GTPase superfamily, which encodes two highly related protein isoforms, KRas4B and KRas4A. KRas4B and KRas4A consist of 188 and 189 amino acids, respectively, due to different clipping of the fourth exon in mammalian cells. These proteins have different structures in their C-terminal region. KRas4B contains a polybasic stretch of eight lysines and KRas4A presents a palmitoylated cysteine and two polybasic regions. The localization and trafficking of KRas4B relies on the presence of polybasic residues that anchor the protein to the inner leaflet of the plasma membrane, whereas the membrane-targeting signals in KRas4A are two polybasic regions and an additional palmitoyl group, that independently contribute to the plasma membrane localization and signal output.<br>The term KRas is generally referred to as KRas4B due to the high level of mRNA encoding KRas4B in cells. KRas4B is by far the mo
$133.00 - $5,666.00
Buy now
Recombinant Human KRas4B (G12V, His-Tag)
Beyotime’s recombinant human KRas4B G12D (rhKRas4B G12D) was expressed in E.coli and purified, which mutate the code 12 glycine to cysteine of the mature form KRas4B (2-186aa) fusion with 6X His tag (HHHHHH) at the N-terminus.<br>KRas gene located on the 12p11.1–12p12.1. The KRas is a member of the small GTPase superfamily, which encodes two highly related protein isoforms, KRas4B and KRas4A. KRas4B and KRas4A consist of 188 and 189 amino acids, respectively, due to different clipping of the fourth exon in mammalian cells. These proteins have different structures in their C-terminal region. KRas4B contains a polybasic stretch of eight lysines and KRas4A presents a palmitoylated cysteine and two polybasic regions. The localization and trafficking of KRas4B relies on the presence of polybasic residues that anchor the protein to the inner leaflet of the plasma membrane, whereas the membrane-targeting signals in KRas4A are two polybasic regions and an additional palmitoyl group, that independently contribute to the plasma membrane localization and signal output.<br>The term KRas is generally referred to as KRas4B due to the high level of mRNA encoding KRas4B in cells. KRas4B is by far the mo
$133.00 - $5,666.00
Buy now
Recombinant Human KRas4B (G12D, His-Tag)
Beyotime’s recombinant human KRas4B G12D (rhKRas4B G12D) was expressed in E.coli and purified, which mutate the code 12 glycine to cysteine of the mature form KRas4B (2-186aa) fusion with 6X His tag (HHHHHH) at the N-terminus.<br>KRas gene located on the 12p11.1–12p12.1. The KRas is a member of the small GTPase superfamily, which encodes two highly related protein isoforms, KRas4B and KRas4A. KRas4B and KRas4A consist of 188 and 189 amino acids, respectively, due to different clipping of the fourth exon in mammalian cells. These proteins have different structures in their C-terminal region. KRas4B contains a polybasic stretch of eight lysines and KRas4A presents a palmitoylated cysteine and two polybasic regions. The localization and trafficking of KRas4B relies on the presence of polybasic residues that anchor the protein to the inner leaflet of the plasma membrane, whereas the membrane-targeting signals in KRas4A are two polybasic regions and an additional palmitoyl group, that independently contribute to the plasma membrane localization and signal output.<br>The term KRas is generally referred to as KRas4B due to the high level of mRNA encoding KRas4B in cells. KRas4B is by far the mo
$133.00 - $5,666.00
Buy now
Recombinant Human KRas4B (G12C, His-Tag)
Beyotime’s recombinant human KRas4B (rhKRas4B) was expressed in E.coli and purified, which contain the mature form KRas4B (2-186aa) fusion with 6X His tag (HHHHHH) at the N-terminus.<br>Ras (KRas, HRas and NRas) is the most frequently mutated gene family in cancers,they differ significantly only in the C-terminal 40 amino acids. These Ras genes have GTP/GDP binding and GTPase activity, and their normal function may be as G-like regulatory proteins involved in the normal control of cell growth. Ras directly interacts with and activates several downstream effector pathways including the mitogen-activated protein kinase (MAPK) and phosphatidylinositol 3-kinase (PI3K) pathways. Mutations in Ras gene disrupt the guanine exchange cycle, typically by becoming GAP-independent and ‘locking’ Ras in the active, GTP-bound state, thereby activating downstream signaling pathways resulting in tumor cell growth.<br>KRas was first identified as a viral oncogene in the Kirsten Rat Sarcoma virus and KRas protein was first found as a p21 GTPase. The protein relays signals from outside the cell to the cell’s nucleus. These signals instruct the cell to grow and divide (proliferate) or to mature and take on sp
$133.00 - $5,666.00
Show more
Home
Journals
Contact
Posts
Cookie Use
We use cookies to ensure a smooth browsing experience. By continuing we assume you accept the use of cookies.
Accept
Learn More